Your Basket 0

 

Ordering Details

Cat Number:OASE00303
Size:100ug
Concentration:1 mg/mL
Price:£495.00
Quantity:
Shipping:£12.00

Document Links

Data Sheet

 

Ataxin 1, Monoclonal Antibody

Partner: Aviva Systems Biology

Applications:WB, IHC, ICC, IF, IP
Species Reactivity:Human, Mouse, Rat
Dilutions:WB (1:1000), ICC/IF (1:100); optimal dilutions for assays should be determined by the user.
Immunogen:Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Purification:Protein G Purified
Conjugation:Unconjugated
Description:Ataxin-1 is a member of the ATXN1 protein family and contains a single AXH domain. It is a neurodegenerative disorder protein thought to have a role in the metabolism of RNA as it has been shown to localize to the RNA and transcription dependent inclusions within the nucleus. A mutation of Ataxin-1 is the cause of spinocerebellar ataxia type-1 (SCA1), a progressive, neurodegenerative disease that is autosomal dominant and primarily affects the Purjinke cells found in brain stem neuronal populations and the cerebellum. Expression of Ataxin-1 is almost ubiquitous, except in the brain where it is isolated to populations of neurons.
Shipping Conditions:Ship on cold packs
Usage:Research Use Only

 

Insight Biotechnology Ltd reserves the right to change pricing without notice