AMH, Monoclonal Antibody
Partner: Aviva Systems Biology
Applications: | IHC-FFPE, WB |
Species Reactivity: | Human |
Isotype: | IgG1 |
Immunogen: | The immunogen for anti-AMH antibody: synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC) |
Conjugation: | Unconjugated |
Shipping Conditions: | Ship on cold packs |
Usage: | Research Use Only |
Insight Biotechnology Ltd reserves the right to change pricing without notice