STATHMIN 1 [N-term], Rabbit Polyclonal Antibody
Partner: Aviva Systems Biology
Applications: | WB, IHC-P, ICC/IF, FCM |
Isotype: | Rabbit IgG |
Immunogen: | A synthetic peptide corresponding to a sequence at the N-terminus of human Stathmin 1 (2-34aa ASSDIQVKELEKRASGQAFELILSPRSKESVPE), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. |
Purification: | Immunogen affinity purified. |
Conjugation: | Unconjugated |
Description: | Rabbit IgG polyclonal antibody for Stathmin(STMN1) detection. Tested with WB, IHC-P, ICC/IF, FCM in Human;Mouse;Rat. |
Shipping Conditions: | Ship at ambient |
Usage: | Research Use Only |
Insight Biotechnology Ltd reserves the right to change pricing without notice