| Applications: | WB, IHC-P, IHC-F, ICC, FCM |
| Isotype: | Rabbit IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids. |
| Purification: | Immunogen affinity purified. |
| Conjugation: | Unconjugated |
| Description: | Rabbit IgG polyclonal antibody for Beclin 1-associated autophagy-related key regulator (ATG14) detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human;Rat. |
| Shipping Conditions: | Ship at ambient |
| Usage: | Research Use Only |
