ALDH2 [N-term], Rabbit Polyclonal Antibody
Partner: Aviva Systems Biology
| Applications: | WB, IHC-P, ICC/IF |
| Isotype: | Rabbit IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH2 (18-48aa SAAATQAVPAPNQQPEVFCNQIFINNEWHDA), different from the related mouse sequence by two amino acids, and from the related rat sequence by one amino acid. |
| Purification: | Immunogen affinity purified. |
| Conjugation: | Unconjugated |
| Description: | Rabbit IgG polyclonal antibody for Aldehyde dehydrogenase, mitochondrial(ALDH2) detection. Tested with WB, IHC-P, ICC/IF in Human;Mouse;Rat. |
| Shipping Conditions: | Ship at ambient |
| Usage: | Research Use Only |
Insight Biotechnology Ltd reserves the right to change pricing without notice
