VILLIN [C-term], Rabbit Polyclonal Antibody
Partner: Aviva Systems Biology
Applications: | WB, IHC-P, IF, FCM |
Isotype: | Rabbit IgG |
Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT), different from the related mouse sequence by three amino acids. |
Purification: | Immunogen affinity purified. |
Conjugation: | Unconjugated |
Description: | Rabbit IgG polyclonal antibody for Villin-1(VIL1) detection. Tested with WB, IHC-P, IF, FCM in Human;Mouse;Rat. |
Shipping Conditions: | Ship at ambient |
Usage: | Research Use Only |
Insight Biotechnology Ltd reserves the right to change pricing without notice