TH [Middle], Rabbit Polyclonal Antibody
Partner: Aviva Systems Biology
Applications: | WB, IHC-P, ICC/IF |
Species Reactivity: | Human |
Isotype: | Rabbit IgG |
Immunogen: | A synthetic peptide corresponding to a sequence in the middle region of human Tyrosine Hydroxylase (193-222aa KVPWFPRKVSELDKCHHLVTKFDPDLDLDH), identical to the related mouse and rat sequences. |
Purification: | Immunogen affinity purified. |
Conjugation: | Unconjugated |
Description: | Rabbit IgG polyclonal antibody for Tyrosine 3-monooxygenase(TH) detection. Tested with WB, IHC-P, ICC/IF in Human;Mouse;Rat. |
Shipping Conditions: | Ship at ambient |
Usage: | Research Use Only |
Insight Biotechnology Ltd reserves the right to change pricing without notice