ABCB1 [Middle], Rabbit Polyclonal Antibody
Partner: Aviva Systems Biology
Applications: | IHC-P, IHC-F |
Isotype: | Rabbit IgG |
Immunogen: | A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids. |
Purification: | Immunogen affinity purified. |
Conjugation: | Unconjugated |
Description: | Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human;Mouse;Rat. |
Shipping Conditions: | Ship at ambient |
Usage: | Research Use Only |
Insight Biotechnology Ltd reserves the right to change pricing without notice