| Applications: | IHC |
| Species Reactivity: | Human |
| Isotype: | Mouse / IgG1, kappa + Mouse / IgG1, kappa |
| Immunogen: | Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1). |
| Purification: | Protein A/G |
| MW: | 114078 MW |
| Description: | Boster Bio Anti-DOG-1 / TMEM16A / ANO1 (Gastrointestinal Stromal Tumor Marker) Monoclonal Antibody catalog # M30940. Tested in IHC applications. This antibody reacts with Human. |
| Synonym: | Anoctamin-1;Discovered on gastrointestinal stromal tumors protein 1;Oral cancer overexpressed protein 2;Transmembrane protein 16A;Tumor-amplified and overexpressed sequence 2;ANO1;DOG1, ORAOV2, TAOS2, TMEM16A; |
| Shipping Conditions: | Ship on cold packs |
| Storage: | Antibody with azide - store at 2 to 8 C. Antibody without azide - store at -20 to -80 C. Antibody is stable for 24 months. Non-hazardous. No MSDS required. |
| Usage: | Research use only |
