Your Basket 0

 

Ordering Details

Cat Number:HY-P73565A-50ug
Size:50ug
Price:£192.00
Quantity:
Shipping:£12.00

 

Tubulin cofactor A, Human (Tag Free)

Partner: MedChemexpress LLC

MW:Approximately 14 kDa
Formula:6902(Gene_ID)O75347 (M1-A108)(Accession)
SMILES:MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
Purity:95.0
Description:Tubulin cofactor A Protein, a pivotal tubulin-folding protein, initiates the tubulin folding pathway within a supercomplex (cofactors A to E). Cofactors A and D capture and stabilize tubulin in a quasi-native state. Cofactor E's interaction with the cofactor D-tubulin complex facilitates binding to cofactor C, releasing tubulin polypeptides committed to adopting the native state. Tubulin cofactor A Protein orchestrates these steps, emerging as a key player in early tubulin folding, forming a functional and stable tubulin structure. Tubulin cofactor A Protein, Human (Tag Free) is the recombinant human-derived Tubulin cofactor A protein, expressed by E. coli, with tag free. The total length of Tubulin cofactor A Protein, Human (Tag Free) is 108 a.a., with molecular weight of ~14 kDa.
Shipping Conditions:Ship on cold packs
Usage:Research Use Only

 

Insight Biotechnology Ltd reserves the right to change pricing without notice