| Applications: | IHC, IHC-P, WB |
| Species Reactivity: | Human, Mouse, Rat, Sheep, Baboon, Squirrel monkey |
| Isotype: | Mouse IgG1 |
| Purification: | Tissue Culture Supernatant |
| Conjugation: | Unconjugated |
| MW: | 59 kDa |
| Description: | Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. |
| Further Information: | Immunogen Region: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC) Concentrated Tissue Culture Supernatant |
| Synonym: | MIF Antibody | anti-Mullerian hormone Antibody | MIS Antibody |
| NCBI EntrezGene: | 268 |
| Shipping Conditions: | Ship on cold packs |
| Storage: | Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4 C. For long-term storage, aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles. |
| Usage: | Research use only |
