Ordering Details
Cat Number:	GTX13868
Size:	100uL
Concentration:	1mg/mL
Price:	£384.00
Quantity:
Shipping:	£12.00

Document Links

Data Sheet

TLR5, Rabbit Polyclonal Antibody

Partner: GeneTex International Corporation

Applications:	FACS, IHC-P, WB
Species Reactivity:	Human, Mouse, Rat, Pig
Isotype:	Rabbit IgG
Purification:	Protein G purified
Conjugation:	Unconjugated
MW:	98 kDa
Description:	The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity.
Further Information:	Immunogen Region: Synthetic peptide: VFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGE , corresponding to amino acids 300-350 of Human TLR5. Protein G purified Positive Controls: Ramos and Raw cell lysate
Synonym:	MELIOS antibody \| SLE1 antibody \| SLEB1 antibody \| TIL3 antibody
NCBI EntrezGene:	7100
Shipping Conditions:	Ship on cold packs
Storage:	Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4 C. For long-term storage, aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles.
Usage:	Research use only

Insight Biotechnology Ltd reserves the right to change pricing without notice

FACS (Intracellular staining) analysis of mouse splenocytes using GTX13868 TLR5 antibody. Red : Primary antibody Green : isotype control Shaded histogram : cell only Dilution : 2 ug/10? cells