Ordering Details
Cat Number:	GTX13732
Size:	50ug
Concentration:	1mg/mL
Price:	£358.00
Quantity:
Shipping:	£12.00

Document Links

Data Sheet

TLR7, Rabbit Polyclonal Antibody

Partner: GeneTex International Corporation

Applications:	FACS, IHC-Fr, IHC-P
Species Reactivity:	Human, Mouse
Isotype:	Rabbit IgG
Purification:	Protein G purified
Conjugation:	Unconjugated
MW:	121 kDa
Description:	The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity.
Further Information:	Immunogen Region: Synthetic peptide: LKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKN conjugated to KLH, corresponding to amino acids 650-700 of Human TLR7. Protein G purified Positive Controls: Ramos cells
Synonym:	TLR7-like antibody
NCBI EntrezGene:	51284
Shipping Conditions:	Ship on cold packs
Storage:	Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4 C. For long-term storage, aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles.
Usage:	Research use only

Insight Biotechnology Ltd reserves the right to change pricing without notice

IHC-P analysis of human brain tissue using GTX13732 TLR7 antibody. Dilution : 1:20 Antigen retrieval : Heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0)