| Applications: | FACS, ICC/IF, IHC-P, WB |
| Species Reactivity: | Human, Mouse, Rat, Bovine, Dog |
| Isotype: | Mouse IgG1 |
| Purification: | Protein G purified |
| Conjugation: | Unconjugated |
| MW: | 33 kDa |
| Description: | Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. |
| Further Information: | Immunogen Region: Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1. Protein G purified Positive Controls: Recombinant Human or Rat HO-1 (Hsp32) Protein |
| Synonym: | Heme Oxygenase 1, 141250, 3162, HO1, Heme Oxygenase1, P09601, HO-1, HMOX1, bK286B10, HO 1 |
| NCBI EntrezGene: | 3162 |
| Shipping Conditions: | Ship on cold packs |
| Storage: | Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4 C. For long-term storage, aliquot and store at -20C or below. Avoid multiple freeze-thaw cycles. |
| Usage: | Research use only |
