| Applications: | WB, IHC-P, FACS, ELISA |
| Species Reactivity: | Human, Mouse, Rat |
| Dilutions: | WB: 0.1-0.5ug/ml. IHC-P: 0.5-1ug/ml. FACS: 1-3ug/1x10^6; cells. ELISA: 0.1-0.5ug/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications. |
| Isotype: | Rabbit IgG |
| Immunogen: | A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids. |
| Purification: | Purified by antigen-affinity chromatography |
| Conjugation: | Unconjugated |
| Further Information: | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate |
| Synonym: | bone morphogenetic protein 5 |
| NCBI EntrezGene: | 653 |
| Shipping Conditions: | Ship on cold packs |
| Storage: | Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4 C. For long-term storage, aliquot and store at -20 C or below. Avoid multiple freeze-thaw cycles. |
| Usage: | Research use only |
