| Applications: | ELISA |
| Species Reactivity: | Human |
| Isotype: | Rabbit IgG |
| Immunogen: | NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
| Purification: | Immunogen affinity purified. |
| Description: | Boster Bio Anti-SARS-CoV-2 NSP9 Antibody catalog # A30395. Tested in ELISA applications. This antibody reacts with Human. |
| Synonym: | Replicase polyprotein 1ab; pp1ab; ORF1ab polyprotein; nsp9; Non-structural protein 9 |
| Shipping Conditions: | Ship on cold packs |
| Storage: | Store at -20 C for one year from date of receipt. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for six months. Avoid repeated freeze-thaw cycles. |
| Usage: | Research Use Only |
