| Applications: | IF, IHC |
| Species Reactivity: | Human, Mouse |
| Isotype: | Goat IgG |
| Immunogen: | Synthetic peptide corresponding to aa 161-192 (L^161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC^192) of the N-terminal domain of human TLR4 (Toll-like receptor 4). |
| Purification: | Epitope-affinity purified IgG. |
| Description: | Boster Bio Anti-Toll-like Receptor 4 TLR4 Antibody catalog # A00017. Tested in IF, IHC applications. This antibody reacts with Human, Mouse. |
| Shipping Conditions: | Ship on cold packs |
| Storage: | Store at -20 C for one year. For short term storage and frequent use, store at 4 C for up to one month. Avoid repeated freeze-thaw cycles. |
| Usage: | Research use only |
